NR.    ID         STRID   %IDE  IDcalc  Nres  Weight 
    0 : parent_seq  predA                    89 0.0476 0.0172
    1 : QUERY   1           1.00    0.00      0 0.0000 0.0000
    2 : 2780983 10          1.00    0.00      0 0.0000 0.0000
    3 : 120186  10          0.99    0.99     89 0.0459 0.0127
    4 : 2773321 10          0.99    0.00      0 0.0000 0.0000
    5 : 999791  10          0.98    0.98     89 0.0482 0.0173
    6 : 443491  10          0.98    0.98     89 0.0482 0.0173
    7 : 2773326 10          0.97    0.97     89 0.0484 0.0214
    8 : 2773316 10          0.96    0.96     84 0.0491 0.0259
    9 : 1169684 12          0.85    0.85     87 0.0547 0.0273
   10 : 2731435 11          0.75    0.74     87 0.0633 0.0416
   11 : 385842              0.50    0.48     25 0.0362 0.0185
   12 : 1346014 398         0.50    0.50     40 0.0458 0.0013
   13 : 628458  403         0.46    0.46     67 0.0459 0.0114
   14 : 1171795 403         0.46    0.00      0 0.0000 0.0000
   15 : 128599  402         0.45    0.43     67 0.0479 0.0121
   16 : 43898   428         0.44    0.41     41 0.0419 0.0041
   17 : 128601  428         0.44    0.00      0 0.0000 0.0000
   18 : 417388  428         0.44    0.41     41 0.0417 0.0040
   19 : 73056   427         0.44    0.00      0 0.0000 0.0000
   20 : 1171797 428         0.44    0.00      0 0.0000 0.0000
   21 : 1220107 28          0.44    0.00      0 0.0000 0.0000
   22 : 585585  1           0.43    0.45     56 0.0414 0.0092
   23 : 1245756 385         0.42    0.41     13 0.1848 0.0000
   24 : 128604  377         0.42    0.40     67 0.0496 0.0128
   25 : 2338727 444         0.42    0.40     43 0.0472 0.0050
   26 : 2120004 403         0.42    0.41     70 0.0470 0.0152
   27 : 128603  404         0.42    0.41     70 0.0478 0.0153
   28 : 2598277 403         0.42    0.42     53 0.0478 0.0133
   29 : 310877  415         0.42    0.40     48 0.0477 0.0083
   30 : 541305  375         0.41    0.42     67 0.0497 0.0126
   31 : 927310  402         0.41    0.39     67 0.0502 0.0135
   32 : 2147074 601         0.39    0.36     44 0.0536 0.0201
   33 : 2126280 444         0.37    0.35     43 0.0493 0.0053
   34 : 128602  386         0.25    0.24     85 0.0969 0.0674
 Done writing: predA
 ###Parent sequence is: 
VLTVSTVNSQDQVTQKPLRDSVKQALENYFAQLNGQDVNDLYELVLAEVE
QPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
 ###end of parent sequence