One-dimensional PHI/PSI region output format


A 1-D phi/psi region output looks like a secondary structure prediction,
but the "loop" positions are actually specific regions
of phi/psi space, as chown in the diagram. However, the "E"
positions in this representation only indicate predicted
"sheet" backbone angles, NOT sheet hydrogen bonding. Backbone
angles in all regions, including "E" and "H", occur in turns.
------------ ONE-LETTER CODE FOR PHI/PSI REGIONS ------------- | H = helix = -180 < phi < 0 & -100 < psi < -10 | | E = ext'd = -200 < phi < 20 & +40 < psi < 260 | | G = turn = -180 < phi < 0 & -10 < psi < +40 | | L = turn = 0 < phi < 180 & -90 < psi < +90 | | X = turn = 20 < phi < 160 & +90 < psi < -90 | -------------------------------------------------------------- | ROUGH OUTLINE of the populated Ramachandran regions | -------------------------------------------------------------- |EEEEEEEEEEEEEEEEEEEEEEEEEEEEE| XXXXXXXXXXXX EE| |EEEEEEEEEEEEEEEEEEEEEEEEEEEEE|EE XXXXXXXXXXXX EE| |EEEEEEEEEEEEEEEEEEEEEEEEEEEEE|EE EE| |EEEEEEEEEEEEEEEEEEEEEEEEEEEEE|EE EE| | EEEEEEEEEEEEEEEEEEEEEEEEEE|EE | | EEEEEEEEEEEEEEEEEEEEEEEEEE|EE | | EEEEEEEEEEEEEEEEEEEEEEE| | | EEEEEEEEEEEEEEEEEEEEEEE| | | EEEEEEEEEEEEEEEEEEEEEEE| LLLLLLLLLLLLLLLLLL | | EEEEEEEEEEEEEEEEEEEEE | LLLLLLLLLLLLLLLLLL | | GGGGGGGGGGGGGGG | LLLLLLLLLLLLLLLLLL | | GGGGGGGGGGGGGGG | LLLLLLLLLLLLLLLLLL | | GGGGGGGGGGGGGGG | LLLLLLLLLLLLLLLLLL | | GGGGGGGGGGGGGGG | LLLLLLLLLLLLLLLLLL | |------------------------------------------------------------| | GGGGGGG | LLLLLLLLLLLLLLLLLL | | GGGGG | LLLLLLLLLLLLLLLLLL | | HHHHH | LLLLLLLLLLLLLLLLLL | | HHHHHH | LLLLLLLLLLLLLLLLLL | | HHHHH | | | HHHH | | | | | | | | | | | | | | | | | | | | | | XXXXXXXXXXXX | |EEEEEEEEEEEEEEEEEEEEEEE | XXXXXXXXXXXX EE| -------------------------------------------------------------- ------------- I-SITES PREDICTED PHI/PSI REGIONS -------------- ( "P" regions predicted by PHD ) ....,....1....,....2....,....3....,....4....,....5 Sequence : ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDA Confidence: 35999935555566665566666569998998456555554444444557 Phi/psi : EEEEEEEEHGHHHHHHHHHHHHHHELEEEEEEEEGHHHHHHEEEEEEEEE : PPPPPP PPPPPPPP PPPPP ....,....6....,....7....,....8....,....9....,....0 Sequence : PKELLQMLEKQKK Confidence: 7999999997773 Phi/psi : HHHHHHHHHHHHH : PPPPPPPPP